PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009760288.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 258aa    MW: 28099.2 Da    PI: 9.4039
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009760288.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.7e-392080262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    k++a++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rkn+k+s
  XP_009760288.1 20 KDQAINCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGGSRKNNKRS 80
                    5799*****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-27772IPR003851Zinc finger, Dof-type
PfamPF027013.4E-332178IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7792478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MAAEIAAPNV TVEKKVRPVK DQAINCPRCN STNTKFCYYN NYSLTQPRYF CKTCRRYWTE  60
GGTLRNVPVG GGSRKNNKRS SSSSSSSQKL PDLNPNPSFS PQNPNKIIVG NSCQDLNLGF  120
QTVSHDHHQF HGVPQFLELP KMDSSNNGNN HLGSTPISAL ELLRTGIASR GFTSFITSPA  180
PPDLNTLYTS GFPFQELKPR AGSNDHAAAA LSYSNGVQEN GGARIMFPLG ADHHHHQSKG  240
QENSTAGYWN GMLGGGSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760286.10.0PREDICTED: dof zinc finger protein DOF2.5 isoform X1
RefseqXP_009760288.10.0PREDICTED: dof zinc finger protein DOF2.5 isoform X3
RefseqXP_016463171.10.0PREDICTED: dof zinc finger protein DOF2.5-like isoform X2
TrEMBLK4B0011e-108K4B001_SOLLC; Uncharacterized protein
TrEMBLM0ZGK71e-108M0ZGK7_SOLTU; Uncharacterized protein
STRINGSolyc01g096120.2.11e-107(Solanum lycopersicum)
STRINGPGSC0003DMT4000003491e-107(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.41e-52Dof family protein